Class b: All beta proteins [48724] (174 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) |
Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins) |
Protein Heat-labile toxin [50205] (2 species) |
Species Escherichia coli, type IB [TaxId:562] [50206] (20 PDB entries) |
Domain d1ltrg_: 1ltr G: [24958] extended C-terminally with a peptide with anti-hsv activity |
PDB Entry: 1ltr (more details), 3.04 Å
SCOP Domain Sequences for d1ltrg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ltrg_ b.40.2.1 (G:) Heat-labile toxin {Escherichia coli, type IB [TaxId: 562]} apqsitelcseyhntqiytindkilsytesmagkremviitfksgatfqvevpgsqhids qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismekly
Timeline for d1ltrg_:
View in 3D Domains from other chains: (mouse over for more information) d1ltrd_, d1ltre_, d1ltrf_, d1ltrh_ |