Lineage for d3sr7b_ (3sr7 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080000Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2080511Family c.1.4.0: automated matches [191310] (1 protein)
    not a true family
  6. 2080512Protein automated matches [190048] (21 species)
    not a true protein
  7. 2080608Species Streptococcus mutans [TaxId:1309] [255997] (2 PDB entries)
  8. 2080610Domain d3sr7b_: 3sr7 B: [249571]
    automated match to d1vcfa1
    complexed with po4

Details for d3sr7b_

PDB Entry: 3sr7 (more details), 2.04 Å

PDB Description: Crystal structure of S. mutans isopentenyl pyrophosphate isomerase
PDB Compounds: (B:) Isopentenyl-diphosphate delta-isomerase

SCOPe Domain Sequences for d3sr7b_:

Sequence, based on SEQRES records: (download)

>d3sr7b_ c.1.4.0 (B:) automated matches {Streptococcus mutans [TaxId: 1309]}
ynsfddielihhslpdydlaeidlsthfagqdfdfpfyinamtggsqkgkevneklaqva
dtcgllfvtgsystalknpddtsyqvkksrphlllatnigldkpyqaglqavrdlqplfl
qvhinlmqellmpegerefrswkkhlsdyakklqlpfilkevgfgmdvktiqtaidlgvk
tvdisgrggtsfayienrrggnrsylnqwgqttaqvllnaqplmdkveilasggirhpld
iikalvlgakavglsrtmlelveqhsvheviaivngwkedlrlimcalncqtiaelrnvd
yllygrlregqrq

Sequence, based on observed residues (ATOM records): (download)

>d3sr7b_ c.1.4.0 (B:) automated matches {Streptococcus mutans [TaxId: 1309]}
ynsfddielihhslpdydlaeidlsthfagqdfdfpfyinamgkevneklaqvadtcgll
fvtphlllatnigldkpyqaglqavrdlqplflqvhinlmqelrswkkhlsdyakklqlp
filkevgfgmdvktiqtaidlgvktvdisgrrsylnqwgqttaqvllnaqplmdkveila
sggirhpldiikalvlgakavglsrtmlelveqhsvheviaivngwkedlrlimcalncq
tiaelrnvdyllygrlregqrq

SCOPe Domain Coordinates for d3sr7b_:

Click to download the PDB-style file with coordinates for d3sr7b_.
(The format of our PDB-style files is described here.)

Timeline for d3sr7b_: