Lineage for d3sqjb1 (3sqj B:3-196)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2730252Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 2730253Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 2730697Family a.126.1.0: automated matches [254216] (1 protein)
    not a true family
  6. 2730698Protein automated matches [254493] (6 species)
    not a true protein
  7. 2730831Species Human (Homo sapiens) [TaxId:9606] [255068] (17 PDB entries)
  8. 2730838Domain d3sqjb1: 3sqj B:3-196 [249567]
    automated match to d3jrya1
    complexed with myr

Details for d3sqjb1

PDB Entry: 3sqj (more details), 2.05 Å

PDB Description: Recombinant human serum albumin from transgenic plant
PDB Compounds: (B:) serum albumin

SCOPe Domain Sequences for d3sqjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sqjb1 a.126.1.0 (B:3-196) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hksevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesaenc
dkslhtlfgdklctvatlretygemadccakqepernecflqhkddnpnlprlvrpevdv
mctafhdneetflkkylyeiarrhpyfyapellffakrykaafteccqaadkaacllpkl
delrdegkassakq

SCOPe Domain Coordinates for d3sqjb1:

Click to download the PDB-style file with coordinates for d3sqjb1.
(The format of our PDB-style files is described here.)

Timeline for d3sqjb1: