SCOPe 2.06: Domain d3sqja1: 3sqj A:3-196

Lineage for d3sqja1 (3sqj A:3-196)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
   multihelical; one domain consists of two similar disulfide-linked subdomains

4. Superfamily a.126.1: Serum albumin-like [48552] (2 families)

5. Family a.126.1.0: automated matches [254216] (1 protein)
   not a true family

6. Protein automated matches [254493] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255068] (15 PDB entries)

8. Domain d3sqja1: 3sqj A:3-196 [249564]
   automated match to d3jrya1
   complexed with myr

Details for d3sqja1

PDB Entry: 3sqj, 2.05 Å

PDB Description: Recombinant human serum albumin from transgenic plant

PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d3sqja1:

Sequence; same for both SEQRES and ATOM records:

>d3sqja1 a.126.1.0 (A:3-196) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hksevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesaenc
dkslhtlfgdklctvatlretygemadccakqepernecflqhkddnpnlprlvrpevdv
mctafhdneetflkkylyeiarrhpyfyapellffakrykaafteccqaadkaacllpkl
delrdegkassakq

Timeline for d3sqja1:

• d3sqja1 first appeared in SCOPe 2.04
  
• d3sqja1 appears in SCOPe 2.05
  
• d3sqja1 appears in SCOPe 2.07
  
• d3sqja1 appears in the current release, SCOPe 2.08