Lineage for d3sq9f_ (3sq9 F:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2408110Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2408111Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2408112Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 protein domains)
    automatically mapped to Pfam PF02931
  6. 2408206Protein automated matches [190922] (2 species)
    not a true protein
  7. 2408493Species Human (Homo sapiens) [TaxId:9606] [189722] (4 PDB entries)
  8. 2408519Domain d3sq9f_: 3sq9 F: [249559]
    automated match to d3sq6a_
    complexed with nag

Details for d3sq9f_

PDB Entry: 3sq9 (more details), 3.1 Å

PDB Description: crystal structures of the ligand binding domain of a pentameric alpha7 nicotinic receptor chimera
PDB Compounds: (F:) Neuronal acetylcholine receptor subunit alpha-7, Acetylcholine-binding protein

SCOPe Domain Sequences for d3sq9f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sq9f_ b.96.1.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvvfwlqmswtdhy
lqwnvseypgvkqvsvpisslwvpdlaaynaiskpevltpqlalvnssghvqylpsirqr
fscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkrser
fyecckepypdvtftvtfrkkg

SCOPe Domain Coordinates for d3sq9f_:

Click to download the PDB-style file with coordinates for d3sq9f_.
(The format of our PDB-style files is described here.)

Timeline for d3sq9f_: