Class b: All beta proteins [48724] (176 folds) |
Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) |
Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins) automatically mapped to Pfam PF02931 |
Species Human (Homo sapiens) [TaxId:9606] [189722] (2 PDB entries) |
Domain d3sq9d_: 3sq9 D: [249557] automated match to d3sq6a_ complexed with nag |
PDB Entry: 3sq9 (more details), 3.1 Å
SCOPe Domain Sequences for d3sq9d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sq9d_ b.96.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvvfwlqmswtdhy lqwnvseypgvkqvsvpisslwvpdlaaynaiskpevltpqlalvnssghvqylpsirqr fscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkrser fyecckepypdvtftvtfrkkg
Timeline for d3sq9d_: