Lineage for d3sq9c_ (3sq9 C:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1561825Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 1561826Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 1561827Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
    automatically mapped to Pfam PF02931
  6. Protein automated matches [190922] (2 species)
    not a true protein
  7. 1562031Species Human (Homo sapiens) [TaxId:9606] [189722] (2 PDB entries)
  8. 1562044Domain d3sq9c_: 3sq9 C: [249556]
    automated match to d3sq6a_
    complexed with nag

Details for d3sq9c_

PDB Entry: 3sq9 (more details), 3.1 Å

PDB Description: crystal structures of the ligand binding domain of a pentameric alpha7 nicotinic receptor chimera
PDB Compounds: (C:) Neuronal acetylcholine receptor subunit alpha-7, Acetylcholine-binding protein

SCOPe Domain Sequences for d3sq9c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sq9c_ b.96.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvvfwlqmswtdhy
lqwnvseypgvkqvsvpisslwvpdlaaynaiskpevltpqlalvnssghvqylpsirqr
fscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkrser
fyecckepypdvtftvtfrkkg

SCOPe Domain Coordinates for d3sq9c_:

Click to download the PDB-style file with coordinates for d3sq9c_.
(The format of our PDB-style files is described here.)

Timeline for d3sq9c_: