SCOPe 2.08: Domain d3sp8b1: 3sp8 B:34-126

Lineage for d3sp8b1 (3sp8 B:34-126)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.10: Hairpin loop containing domain-like [57413] (1 superfamily)
   alpha+beta fold with two crossing loops

4. Superfamily g.10.1: Hairpin loop containing domain-like [57414] (3 families)
   the middle part is structurally similar to some knottins and defensins but differs in the disulfide pattern

5. Family g.10.1.1: Hairpin loop containing domain [57415] (2 proteins)
   automatically mapped to Pfam PF00024

6. Protein Hepatocyte growth factor [57416] (1 species)
   heparin-binding domain

7. Species Human (Homo sapiens) [TaxId:9606] [57417] (21 PDB entries)

8. Domain d3sp8b1: 3sp8 B:34-126 [249547]
   Other proteins in same PDB: d3sp8a2, d3sp8a3, d3sp8a4, d3sp8b2, d3sp8b3, d3sp8b4
   automated match to d1bhta1
   complexed with mes, mpd, mrd, so4

Details for d3sp8b1

PDB Entry: 3sp8, 1.86 Å

PDB Description: Crystal structure of NK2 in complex with fractionated Heparin DP10

PDB Compounds: (B:) Hepatocyte growth factor alpha chain

SCOPe Domain Sequences for d3sp8b1:

Sequence; same for both SEQRES and ATOM records:

>d3sp8b1 g.10.1.1 (B:34-126) Hepatocyte growth factor {Human (Homo sapiens) [TaxId: 9606]}
krrntihefkksakttlikidpalkiktkkvntadqcanrctrnkglpftckafvfdkar
kqclwfpfnsmssgvkkefghefdlyenkdyir

Timeline for d3sp8b1:

• d3sp8b1 first appeared in SCOPe 2.04
  
• d3sp8b1 appears in SCOPe 2.07