Lineage for d3sp8a3 (3sp8 A:211-288)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033267Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 3033268Superfamily g.14.1: Kringle-like [57440] (3 families) (S)
  5. 3033269Family g.14.1.1: Kringle modules [57441] (7 proteins)
  6. 3033286Protein NK1 fragment of hepatocyte growth factor [57457] (1 species)
  7. 3033287Species Human (Homo sapiens) [TaxId:9606] [57458] (20 PDB entries)
  8. 3033289Domain d3sp8a3: 3sp8 A:211-288 [249546]
    Other proteins in same PDB: d3sp8a1, d3sp8a4, d3sp8b1, d3sp8b4
    automated match to d1bhta2
    complexed with mes, mpd, mrd, so4

Details for d3sp8a3

PDB Entry: 3sp8 (more details), 1.86 Å

PDB Description: Crystal structure of NK2 in complex with fractionated Heparin DP10
PDB Compounds: (A:) Hepatocyte growth factor alpha chain

SCOPe Domain Sequences for d3sp8a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sp8a3 g.14.1.1 (A:211-288) NK1 fragment of hepatocyte growth factor {Human (Homo sapiens) [TaxId: 9606]}
cmtsngesyrglmdhtesgkicqrwdhqtphrhkflperypdkgfddnycrnpdgqprpw
cytldphtrweyckiktc

SCOPe Domain Coordinates for d3sp8a3:

Click to download the PDB-style file with coordinates for d3sp8a3.
(The format of our PDB-style files is described here.)

Timeline for d3sp8a3: