Class g: Small proteins [56992] (100 folds) |
Fold g.14: Kringle-like [57439] (1 superfamily) disulfide-rich fold; nearly all-beta |
Superfamily g.14.1: Kringle-like [57440] (3 families) |
Family g.14.1.1: Kringle modules [57441] (7 proteins) |
Protein NK1 fragment of hepatocyte growth factor [57457] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57458] (20 PDB entries) |
Domain d3sp8a3: 3sp8 A:211-288 [249546] Other proteins in same PDB: d3sp8a1, d3sp8a4, d3sp8b1, d3sp8b4 automated match to d1bhta2 complexed with mes, mpd, mrd, so4 |
PDB Entry: 3sp8 (more details), 1.86 Å
SCOPe Domain Sequences for d3sp8a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sp8a3 g.14.1.1 (A:211-288) NK1 fragment of hepatocyte growth factor {Human (Homo sapiens) [TaxId: 9606]} cmtsngesyrglmdhtesgkicqrwdhqtphrhkflperypdkgfddnycrnpdgqprpw cytldphtrweyckiktc
Timeline for d3sp8a3:
View in 3D Domains from other chains: (mouse over for more information) d3sp8b1, d3sp8b2, d3sp8b3, d3sp8b4 |