Class g: Small proteins [56992] (98 folds) |
Fold g.10: Hairpin loop containing domain-like [57413] (1 superfamily) alpha+beta fold with two crossing loops |
Superfamily g.10.1: Hairpin loop containing domain-like [57414] (3 families) the middle part is structurally similar to some knottins and defensins but differs in the disulfide pattern |
Family g.10.1.1: Hairpin loop containing domain [57415] (2 proteins) automatically mapped to Pfam PF00024 |
Protein Hepatocyte growth factor [57416] (1 species) heparin-binding domain |
Species Human (Homo sapiens) [TaxId:9606] [57417] (21 PDB entries) |
Domain d3sp8a1: 3sp8 A:35-126 [249544] Other proteins in same PDB: d3sp8a2, d3sp8a3, d3sp8a4, d3sp8b2, d3sp8b3, d3sp8b4 automated match to d1bhta1 complexed with mes, mpd, mrd, so4 |
PDB Entry: 3sp8 (more details), 1.86 Å
SCOPe Domain Sequences for d3sp8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sp8a1 g.10.1.1 (A:35-126) Hepatocyte growth factor {Human (Homo sapiens) [TaxId: 9606]} rrntihefkksakttlikidpalkiktkkvntadqcanrctrnkglpftckafvfdkark qclwfpfnsmssgvkkefghefdlyenkdyir
Timeline for d3sp8a1:
View in 3D Domains from other chains: (mouse over for more information) d3sp8b1, d3sp8b2, d3sp8b3, d3sp8b4 |