Lineage for d3so4d3 (3so4 D:239-393)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2215558Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 2215559Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) (S)
  5. 2215664Family d.130.1.0: automated matches [254267] (1 protein)
    not a true family
  6. 2215665Protein automated matches [254617] (10 species)
    not a true protein
  7. 2215689Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [256087] (1 PDB entry)
  8. 2215701Domain d3so4d3: 3so4 D:239-393 [249543]
    automated match to d2p02a3
    complexed with act

Details for d3so4d3

PDB Entry: 3so4 (more details), 3.18 Å

PDB Description: methionine-adenosyltransferase from entamoeba histolytica
PDB Compounds: (D:) Methionine-adenosyltransferase

SCOPe Domain Sequences for d3so4d3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3so4d3 d.130.1.0 (D:239-393) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}
iggpmgdagltgrkiivdtyggwgahgggafsgkdsskvdrsgaycarwiakslvhaglc
hrvlvqlsyaigvshplsinvntygtgicdesilvdivnknfdmrpgmiikelgltrpif
qktavgghfgrndpdfkwefpkeleipaelkpkll

SCOPe Domain Coordinates for d3so4d3:

Click to download the PDB-style file with coordinates for d3so4d3.
(The format of our PDB-style files is described here.)

Timeline for d3so4d3: