Lineage for d3sn9p_ (3sn9 P:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1509632Fold a.265: Fic-like [140930] (1 superfamily)
    multihelical; one central helix is surrounded by seven helices
  4. 1509633Superfamily a.265.1: Fic-like [140931] (1 family) (S)
  5. 1509634Family a.265.1.1: Fic-like [140932] (3 proteins)
    Pfam PF02661; the conserved motif HPFXXGNG is at the N-terminus of the central helix
  6. 1509642Protein automated matches [191277] (2 species)
    not a true protein
  7. 1509645Species Neisseria meningitidis [TaxId:491] [189879] (2 PDB entries)
  8. 1509662Domain d3sn9p_: 3sn9 P: [249528]
    automated match to d3s6aa_
    complexed with anp; mutant

Details for d3sn9p_

PDB Entry: 3sn9 (more details), 3.03 Å

PDB Description: fic protein from neisseria meningitidis mutant s182a/e186a in complex with amppnp
PDB Compounds: (P:) Cell filamentation protein Fic-related protein

SCOPe Domain Sequences for d3sn9p_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sn9p_ a.265.1.1 (P:) automated matches {Neisseria meningitidis [TaxId: 491]}
sideqslhnarrlfesgdidrievgttaglqqihrylfgglydfagqiredniskggfrf
anamylkealvkieqmpertfeeiiakyvemniahpflegngrstriwldlvlkknlkkv
vnwqnvsktlylqamerspvndlelrfllkdnltddvd

SCOPe Domain Coordinates for d3sn9p_:

Click to download the PDB-style file with coordinates for d3sn9p_.
(The format of our PDB-style files is described here.)

Timeline for d3sn9p_: