Lineage for d3sn9n_ (3sn9 N:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2738537Fold a.265: Fic-like [140930] (1 superfamily)
    multihelical; one central helix is surrounded by seven helices
  4. 2738538Superfamily a.265.1: Fic-like [140931] (1 family) (S)
  5. 2738539Family a.265.1.1: Fic-like [140932] (3 proteins)
    Pfam PF02661; the conserved motif HPFXXGNG is at the N-terminus of the central helix
  6. 2738547Protein automated matches [191277] (4 species)
    not a true protein
  7. 2738585Species Neisseria meningitidis [TaxId:491] [189879] (5 PDB entries)
  8. 2738607Domain d3sn9n_: 3sn9 N: [249526]
    automated match to d3s6aa_
    complexed with anp; mutant

Details for d3sn9n_

PDB Entry: 3sn9 (more details), 3.03 Å

PDB Description: fic protein from neisseria meningitidis mutant s182a/e186a in complex with amppnp
PDB Compounds: (N:) Cell filamentation protein Fic-related protein

SCOPe Domain Sequences for d3sn9n_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sn9n_ a.265.1.1 (N:) automated matches {Neisseria meningitidis [TaxId: 491]}
sideqslhnarrlfesgdidrievgttaglqqihrylfgglydfagqiredniskggfrf
anamylkealvkieqmpertfeeiiakyvemniahpflegngrstriwldlvlkknlkkv
vnwqnvsktlylqamerspvndlelrfllkdnltddvd

SCOPe Domain Coordinates for d3sn9n_:

Click to download the PDB-style file with coordinates for d3sn9n_.
(The format of our PDB-style files is described here.)

Timeline for d3sn9n_: