![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.265: Fic-like [140930] (1 superfamily) multihelical; one central helix is surrounded by seven helices |
![]() | Superfamily a.265.1: Fic-like [140931] (1 family) ![]() |
![]() | Family a.265.1.1: Fic-like [140932] (3 proteins) Pfam PF02661; the conserved motif HPFXXGNG is at the N-terminus of the central helix |
![]() | Protein automated matches [191277] (4 species) not a true protein |
![]() | Species Neisseria meningitidis [TaxId:491] [189879] (5 PDB entries) |
![]() | Domain d3sn9k_: 3sn9 K: [249523] automated match to d3s6aa_ complexed with anp; mutant |
PDB Entry: 3sn9 (more details), 3.03 Å
SCOPe Domain Sequences for d3sn9k_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sn9k_ a.265.1.1 (K:) automated matches {Neisseria meningitidis [TaxId: 491]} sideqslhnarrlfesgdidrievgttaglqqihrylfgglydfagqiredniskggfrf anamylkealvkieqmpertfeeiiakyvemniahpflegngrstriwldlvlkknlkkv vnwqnvsktlylqamerspvndlelrfllkdnltddvd
Timeline for d3sn9k_: