Lineage for d1htlf_ (1htl F:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58940Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 59002Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 59003Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 59051Protein Heat-labile toxin [50205] (2 species)
  7. 59052Species Escherichia coli, type IB [TaxId:562] [50206] (17 PDB entries)
  8. 59140Domain d1htlf_: 1htl F: [24952]
    Other proteins in same PDB: d1htl.1

Details for d1htlf_

PDB Entry: 1htl (more details), 2.5 Å

PDB Description: mutation of a buried residue causes lack of activity but no conformational change: crystal structure of e. coli heat-labile enterotoxin mutant val 97--> lys

SCOP Domain Sequences for d1htlf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1htlf_ b.40.2.1 (F:) Heat-labile toxin {Escherichia coli, type IB}
apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn

SCOP Domain Coordinates for d1htlf_:

Click to download the PDB-style file with coordinates for d1htlf_.
(The format of our PDB-style files is described here.)

Timeline for d1htlf_: