SCOP 1.75: Domain d1htle_: 1htl E:

Lineage for d1htle_ (1htl E:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)

6. Protein Heat-labile toxin [50205] (2 species)

7. Species Escherichia coli, type IB [TaxId:562] [50206] (20 PDB entries)

8. Domain d1htle_: 1htl E: [24951]
   Other proteins in same PDB: d1htl.1

Details for d1htle_

PDB Entry: 1htl, 2.5 Å

PDB Description: mutation of a buried residue causes lack of activity but no conformational change: crystal structure of e. coli heat-labile enterotoxin mutant val 97--> lys

PDB Compounds: (E:) heat-labile enterotoxin, subunit b

SCOP Domain Sequences for d1htle_:

Sequence; same for both SEQRES and ATOM records:

>d1htle_ b.40.2.1 (E:) Heat-labile toxin {Escherichia coli, type IB [TaxId: 562]}
apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn

Timeline for d1htle_:

• d1htle_ first appeared (with stable ids) in SCOP 1.55
  
• d1htle_ appears in SCOP 1.73
  
• d1htle_ appears in SCOPe 2.01
  
• d1htle_ appears in the current release, SCOPe 2.08