SCOPe 2.06: Domain d3sm5n2: 3sm5 N:109-211

Lineage for d3sm5n2 (3sm5 N:109-211)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d3sm5n2: 3sm5 N:109-211 [249508]
   Other proteins in same PDB: d3sm5a1, d3sm5a2, d3sm5b_, d3sm5c1, d3sm5c2, d3sm5d_, d3sm5e1, d3sm5e2, d3sm5f_
   automated match to d4m1dl2
   complexed with man, nag, so4

Details for d3sm5n2

PDB Entry: 3sm5, 3.19 Å

PDB Description: influenza hemagglutinin in complex with a neutralizing antibody

PDB Compounds: (N:) CH65, light chain, Fab fragment

SCOPe Domain Sequences for d3sm5n2:

Sequence; same for both SEQRES and ATOM records:

>d3sm5n2 b.1.1.0 (N:109-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gqpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpsk
qsnnkyaassylsltpeqwkshrsyscqvthegstvektvapt

Timeline for d3sm5n2:

• d3sm5n2 first appeared in SCOPe 2.04
  
• d3sm5n2 appears in SCOPe 2.05
  
• d3sm5n2 does not appear in SCOPe 2.07