Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (28 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries) |
Domain d3sm5m2: 3sm5 M:109-211 [249506] Other proteins in same PDB: d3sm5a1, d3sm5a2, d3sm5b_, d3sm5c1, d3sm5c2, d3sm5d_, d3sm5e1, d3sm5e2, d3sm5f_ automated match to d4m1dl2 complexed with man, nag, so4 |
PDB Entry: 3sm5 (more details), 3.19 Å
SCOPe Domain Sequences for d3sm5m2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sm5m2 b.1.1.0 (M:109-211) automated matches {Human (Homo sapiens) [TaxId: 9606]} gqpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpsk qsnnkyaassylsltpeqwkshrsyscqvthegstvektvapt
Timeline for d3sm5m2: