Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein Influenza hemagglutinin (stalk) [58066] (7 species) trimer |
Species Influenza A virus, different strains [TaxId:11320] [58067] (95 PDB entries) |
Domain d3sm5f_: 3sm5 F: [249502] Other proteins in same PDB: d3sm5a_, d3sm5c_, d3sm5e_, d3sm5l1, d3sm5l2, d3sm5m1, d3sm5m2, d3sm5n1, d3sm5n2 automated match to d4n5zb_ complexed with man, nag, so4 |
PDB Entry: 3sm5 (more details), 3.19 Å
SCOPe Domain Sequences for d3sm5f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sm5f_ h.3.1.1 (F:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]} glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn tqftavgkefnklerrmenlnkkvddgfidiwtynaellvllenertldfhdsnvknlye kvksqlknnakeigngcfefyhkcndecmesvkngtydypkyseesklnreki
Timeline for d3sm5f_: