Lineage for d3sjza1 (3sjz A:2-206)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867983Protein automated matches [190047] (37 species)
    not a true protein
  7. 2868735Species Sulfolobus solfataricus [TaxId:273057] [256083] (13 PDB entries)
  8. 2868751Domain d3sjza1: 3sjz A:2-206 [249488]
    Other proteins in same PDB: d3sjza2, d3sjza3
    automated match to d2qn6a3
    protein/RNA complex; complexed with bme, gdp, gnp

Details for d3sjza1

PDB Entry: 3sjz (more details), 2.8 Å

PDB Description: The structure of aIF2gamma subunit delta 41-45 from archaeon Sulfolobus solfataricus complexed with GDP and GDPNP
PDB Compounds: (A:) Translation initiation factor 2 subunit gamma

SCOPe Domain Sequences for d3sjza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sjza1 c.37.1.8 (A:2-206) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
awpkvqpevnigvvghvdhgkttlvqaitgiwtskhseetiklgyaetnigvcesckkpe
ayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaanepfpq
pqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpiipvsal
hkinidsliegieeyiktpy

SCOPe Domain Coordinates for d3sjza1:

Click to download the PDB-style file with coordinates for d3sjza1.
(The format of our PDB-style files is described here.)

Timeline for d3sjza1: