Class b: All beta proteins [48724] (180 folds) |
Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) |
Family b.96.1.0: automated matches [193505] (1 protein) not a true family |
Protein automated matches [193506] (5 species) not a true protein |
Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (67 PDB entries) |
Domain d3siog1: 3sio G:1-207 [249482] Other proteins in same PDB: d3sioa2, d3siob2, d3sioc2, d3siod2, d3sioe2, d3siof2, d3siog2, d3sioh2, d3sioi2, d3sioj2 automated match to d2c9ta_ complexed with mlk, mpd, mrd, nag |
PDB Entry: 3sio (more details), 2.32 Å
SCOPe Domain Sequences for d3siog1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3siog1 b.96.1.0 (G:1-207) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]} hsqanlmrlksdlfnrspmypgptkddpltvylsfslldivkadsstnevdlvyweqqsw klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqnalvnssghvqylpa qrlsfmcdptgvdseegatcavkfgswsyggweidlktdtdqvdlssyyasskyeilsat qtrqvqhysccpepyidvnlvvkfrer
Timeline for d3siog1: