SCOP 1.73: Domain d1ltbe_: 1ltb E:

Lineage for d1ltbe_ (1ltb E:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.40: OB-fold [50198] (12 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)

6. Protein Heat-labile toxin [50205] (2 species)

7. Species Escherichia coli, type IB [TaxId:562] [50206] (19 PDB entries)

8. Domain d1ltbe_: 1ltb E: [24946]
   Other proteins in same PDB: d1ltb.1

Details for d1ltbe_

PDB Entry: 1ltb, 2.6 Å

PDB Description: 2.6 angstroms crystal structure of partially-activated e. coli heat-labile enterotoxin (lt)

PDB Compounds: (E:) heat-labile enterotoxin, subunit b

SCOP Domain Sequences for d1ltbe_:

Sequence; same for both SEQRES and ATOM records:

>d1ltbe_ b.40.2.1 (E:) Heat-labile toxin {Escherichia coli, type IB [TaxId: 562]}
apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn

Timeline for d1ltbe_:

• d1ltbe_ first appeared (with stable ids) in SCOP 1.55
  
• d1ltbe_ appears in SCOP 1.71
  
• d1ltbe_ appears in SCOP 1.75
  
• d1ltbe_ appears in the current release, SCOPe 2.08