Lineage for d1ltbe_ (1ltb E:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 667292Fold b.40: OB-fold [50198] (12 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 667366Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 667367Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 667490Protein Heat-labile toxin [50205] (2 species)
  7. 667491Species Escherichia coli, type IB [TaxId:562] [50206] (19 PDB entries)
  8. 667593Domain d1ltbe_: 1ltb E: [24946]
    Other proteins in same PDB: d1ltb.1

Details for d1ltbe_

PDB Entry: 1ltb (more details), 2.6 Å

PDB Description: 2.6 angstroms crystal structure of partially-activated e. coli heat-labile enterotoxin (lt)
PDB Compounds: (E:) heat-labile enterotoxin, subunit b

SCOP Domain Sequences for d1ltbe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ltbe_ b.40.2.1 (E:) Heat-labile toxin {Escherichia coli, type IB [TaxId: 562]}
apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn

SCOP Domain Coordinates for d1ltbe_:

Click to download the PDB-style file with coordinates for d1ltbe_.
(The format of our PDB-style files is described here.)

Timeline for d1ltbe_: