Lineage for d3sh1j1 (3sh1 J:1-208)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2408110Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2408111Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2408524Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. 2408525Protein automated matches [193506] (5 species)
    not a true protein
  7. 2408526Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (60 PDB entries)
  8. 2408876Domain d3sh1j1: 3sh1 J:1-208 [249449]
    Other proteins in same PDB: d3sh1a2, d3sh1b2, d3sh1c2, d3sh1d2, d3sh1e2, d3sh1f2, d3sh1g2, d3sh1h2, d3sh1i2, d3sh1j2
    automated match to d2ymea_
    complexed with act, bma, mg, mlk, mpd, mrd, nag

Details for d3sh1j1

PDB Entry: 3sh1 (more details), 2.9 Å

PDB Description: ac-achbp ligand binding domain mutated to human alpha-7 nachr
PDB Compounds: (J:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d3sh1j1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sh1j1 b.96.1.0 (J:1-208) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnrspmypgptkddpltvylsfslldivkadsstnevdlvyweqqsw
klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqnalvnssghvqylpa
qrlsfmcdptgvdseegatcavkfgswsyggweidlktdtdqvdlssyyasskyeilsat
qtrserfyecckepypdvnlvvkfrerr

SCOPe Domain Coordinates for d3sh1j1:

Click to download the PDB-style file with coordinates for d3sh1j1.
(The format of our PDB-style files is described here.)

Timeline for d3sh1j1: