SCOP 1.75: Domain d1ltgh_: 1ltg H:

Lineage for d1ltgh_ (1ltg H:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)

6. Protein Heat-labile toxin [50205] (2 species)

7. Species Escherichia coli, type IB [TaxId:562] [50206] (20 PDB entries)

8. Domain d1ltgh_: 1ltg H: [24944]
   Other proteins in same PDB: d1ltg.1
   mutant

Details for d1ltgh_

PDB Entry: 1ltg, 2.4 Å

PDB Description: the arg7lys mutant of heat-labile enterotoxin exhibits great flexibility of active site loop 47-56 of the a subunit

PDB Compounds: (H:) heat-labile enterotoxin

SCOP Domain Sequences for d1ltgh_:

Sequence; same for both SEQRES and ATOM records:

>d1ltgh_ b.40.2.1 (H:) Heat-labile toxin {Escherichia coli, type IB [TaxId: 562]}
apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn

Timeline for d1ltgh_:

• d1ltgh_ first appeared (with stable ids) in SCOP 1.55
  
• d1ltgh_ appears in SCOP 1.73
  
• d1ltgh_ appears in SCOPe 2.01
  
• d1ltgh_ appears in the current release, SCOPe 2.08