![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.68: IF3-like [55199] (8 superfamilies) beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest |
![]() | Superfamily d.68.2: EPT/RTPC-like [55205] (3 families) ![]() |
![]() | Family d.68.2.0: automated matches [191521] (1 protein) not a true family |
![]() | Protein automated matches [190878] (15 species) not a true protein |
![]() | Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [256082] (1 PDB entry) |
![]() | Domain d3sg1d_: 3sg1 D: [249438] automated match to d3vcya_ complexed with pg4, pge |
PDB Entry: 3sg1 (more details), 2.6 Å
SCOPe Domain Sequences for d3sg1d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sg1d_ d.68.2.0 (D:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} mekiivrggkrlngtvrvegaknavlpiiaaallasdgknvlsevpvlsdvytinevlrh lnaevvfennqvtidaskelnieapfeyvrkmrasvqvmgpllarngrarialpggcaig srpidqhlkgfeamgakvqvgngfveayvegelkgakiyldfpsvgatenimsaatlakg ttilenaakepeivdlanflnamgakvrgagtgtiriegvdklyganhsiipdrieagtf mvaaaitggdilienavpehlrsitakmeemgvkiieenegvrvigpdklkavdiktmph pgfptdmqsqmmalllqadgtsmitetvfenrfmhveefrrmnadikiegrsvimngpns lqgaevgatdlraaaalilaglvsegytrvtelkhldrgyvdfhkklaalgatiervne
Timeline for d3sg1d_: