SCOPe 2.06: Domain d3sg0a_: 3sg0 A:

Lineage for d3sg0a_ (3sg0 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.0: automated matches [191439] (1 protein)
   not a true family

6. Protein automated matches [190646] (70 species)
   not a true protein

7. Species Rhodopseudomonas palustris [TaxId:316058] [256081] (3 PDB entries)

8. Domain d3sg0a_: 3sg0 A: [249434]
   automated match to d4gnra_
   complexed with 173

Details for d3sg0a_

PDB Entry: 3sg0, 1.2 Å

PDB Description: the crystal structure of an extracellular ligand-binding receptor from rhodopseudomonas palustris haa2

PDB Compounds: (A:) Extracellular ligand-binding receptor

SCOPe Domain Sequences for d3sg0a_:

Sequence; same for both SEQRES and ATOM records:

>d3sg0a_ c.93.1.0 (A:) automated matches {Rhodopseudomonas palustris [TaxId: 316058]}
qaeikigitmsasgpgaalgqpqsktvaalpkeiggekvtyfalddesdptkaaqnarkl
lseekvdvligssltpvslplidiaaeaktplmtmaaaailvapmderrkwvykvvpndd
imaeaigkyiaktgakkvgyigfsdaygegyykvlaaaapklgfeltthevyarsdasvt
gqvlkiiatkpdavfiasagtpavlpqkalrergfkgaiyqthgvateefiklggkdveg
aifageafsgaedmpadspfrkvkarfvdaykaanggaaptifgvhlwdsmtlvenaipa
alkaakpgtpefraairdqiekskdlalnnglsnmtpdnhngydersaflieirdgafrl
k

Timeline for d3sg0a_:

• d3sg0a_ first appeared in SCOPe 2.04
  
• d3sg0a_ appears in SCOPe 2.05
  
• d3sg0a_ appears in SCOPe 2.07
  
• d3sg0a_ appears in the current release, SCOPe 2.08