Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains |
Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (7 proteins) consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups |
Protein Small cytochrome binding protein CybS [254391] (1 species) Pfam PF05328; PubMed 15989954 |
Species Pig (Sus scrofa) [TaxId:9823] [254827] (5 PDB entries) |
Domain d3sfed_: 3sfe D: [249433] Other proteins in same PDB: d3sfea1, d3sfea2, d3sfea3, d3sfeb1, d3sfeb2, d3sfec_ automated match to d1zoyd_ complexed with f3s, fad, fes, hem, oaa, sf4, tmg |
PDB Entry: 3sfe (more details), 2.81 Å
SCOPe Domain Sequences for d3sfed_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sfed_ f.21.2.2 (D:) Small cytochrome binding protein CybS {Pig (Sus scrofa) [TaxId: 9823]} sskaaslhwtgervvsvlllgllpaaylnpcsamdyslaaaltlhghwgigqvvtdyvrg dalqkaakagllalsaftfaglcyfnyhdvgickavamlwkl
Timeline for d3sfed_: