| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) ![]() two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains |
| Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (7 proteins) consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups |
| Protein Large cytochrome binding protein CybL [254390] (1 species) |
| Species Pig (Sus scrofa) [TaxId:9823] [254826] (5 PDB entries) |
| Domain d3sfec_: 3sfe C: [249432] Other proteins in same PDB: d3sfea1, d3sfea2, d3sfea3, d3sfeb1, d3sfeb2, d3sfed_ automated match to d1zoyc_ complexed with f3s, fad, fes, hem, oaa, sf4, tmg |
PDB Entry: 3sfe (more details), 2.81 Å
SCOPe Domain Sequences for d3sfec_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sfec_ f.21.2.2 (C:) Large cytochrome binding protein CybL {Pig (Sus scrofa) [TaxId: 9823]}
gttakeemerfwnknlgsnrplsphitiyrwslpmamsichrgtgialsagvslfglsal
llpgnfeshlelvkslclgptliytakfgivfplmyhtwngirhliwdlgkgltipqltq
sgvvvliltvlssvglaam
Timeline for d3sfec_: