Lineage for d3sfec_ (3sfe C:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024525Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 3024622Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) (S)
    two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains
  5. 3024642Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (7 proteins)
    consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups
  6. 3024677Protein Large cytochrome binding protein CybL [254390] (1 species)
  7. 3024678Species Pig (Sus scrofa) [TaxId:9823] [254826] (5 PDB entries)
  8. 3024679Domain d3sfec_: 3sfe C: [249432]
    Other proteins in same PDB: d3sfea1, d3sfea2, d3sfea3, d3sfeb1, d3sfeb2, d3sfed_
    automated match to d1zoyc_
    complexed with f3s, fad, fes, hem, oaa, sf4, tmg

Details for d3sfec_

PDB Entry: 3sfe (more details), 2.81 Å

PDB Description: crystal structure of porcine mitochondrial respiratory complex II bound with oxaloacetate and thiabendazole
PDB Compounds: (C:) Succinate dehydrogenase cytochrome b560 subunit, mitochondrial

SCOPe Domain Sequences for d3sfec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sfec_ f.21.2.2 (C:) Large cytochrome binding protein CybL {Pig (Sus scrofa) [TaxId: 9823]}
gttakeemerfwnknlgsnrplsphitiyrwslpmamsichrgtgialsagvslfglsal
llpgnfeshlelvkslclgptliytakfgivfplmyhtwngirhliwdlgkgltipqltq
sgvvvliltvlssvglaam

SCOPe Domain Coordinates for d3sfec_:

Click to download the PDB-style file with coordinates for d3sfec_.
(The format of our PDB-style files is described here.)

Timeline for d3sfec_: