Class a: All alpha proteins [46456] (289 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) contains two Fe4-S4 clusters |
Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins) |
Protein Succinate dehydogenase [81669] (3 species) |
Species Pig (Sus scrofa) [TaxId:9823] [254765] (5 PDB entries) |
Domain d3sfeb2: 3sfe B:115-247 [249431] Other proteins in same PDB: d3sfea1, d3sfea2, d3sfea3, d3sfeb1, d3sfec_, d3sfed_ automated match to d1zoyb2 complexed with f3s, fad, fes, hem, oaa, sf4, tmg |
PDB Entry: 3sfe (more details), 2.81 Å
SCOPe Domain Sequences for d3sfeb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sfeb2 a.1.2.1 (B:115-247) Succinate dehydogenase {Pig (Sus scrofa) [TaxId: 9823]} lsnfyaqyksiepylkkkdesqegkqqylqsieerekldglyecilcaccstscpsywwn gdkylgpavlmqayrwmidsrddfteerlaklqdpfslyrchtimnctgtcpkglnpgka iaeikkmmatyke
Timeline for d3sfeb2: