| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) ![]() |
| Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins) |
| Protein Succinate dehydogenase iron-sulfur protein, N-terminal domain [82586] (3 species) |
| Species Pig (Sus scrofa) [TaxId:9823] [254758] (5 PDB entries) |
| Domain d3sfeb1: 3sfe B:8-114 [249430] Other proteins in same PDB: d3sfea1, d3sfea2, d3sfea3, d3sfeb2, d3sfec_, d3sfed_ automated match to d1zoyb1 complexed with f3s, fad, fes, hem, oaa, sf4, tmg |
PDB Entry: 3sfe (more details), 2.81 Å
SCOPe Domain Sequences for d3sfeb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sfeb1 d.15.4.2 (B:8-114) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
aprikkfaiyrwdpdktgdkphmqtyeidlnncgpmvldalikikneidstltfrrscre
gicgscamninggntlactrridtnldkvskiyplphmyvikdlvpd
Timeline for d3sfeb1: