Lineage for d3sfea3 (3sfe A:446-622)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1481355Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1481443Superfamily a.7.3: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46977] (1 family) (S)
  5. 1481444Family a.7.3.1: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46978] (4 proteins)
  6. 1481481Protein Succinate dehydogenase [81708] (2 species)
  7. 1481497Species Pig (Sus scrofa) [TaxId:9823] [254825] (5 PDB entries)
  8. 1481500Domain d3sfea3: 3sfe A:446-622 [249429]
    Other proteins in same PDB: d3sfea1, d3sfea2, d3sfeb1, d3sfeb2, d3sfec_, d3sfed_
    automated match to d1zoya3
    complexed with f3s, fad, fes, hem, oaa, sf4, tmg

Details for d3sfea3

PDB Entry: 3sfe (more details), 2.81 Å

PDB Description: crystal structure of porcine mitochondrial respiratory complex II bound with oxaloacetate and thiabendazole
PDB Compounds: (A:) Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial

SCOPe Domain Sequences for d3sfea3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sfea3 a.7.3.1 (A:446-622) Succinate dehydogenase {Pig (Sus scrofa) [TaxId: 9823]}
ageesvmnldklrfangtirtselrlsmqksmqshaavfrvgsvlqegcekilrlygdlq
hlktfdrgmvwntdlvetlelqnlmlcalqtiygaearkesrgaharedfkervdeydys
kpiqgqqkkpfqehwrkhtlsyvdvktgkvsleyrpvidktlneadcatvppairsy

SCOPe Domain Coordinates for d3sfea3:

Click to download the PDB-style file with coordinates for d3sfea3.
(The format of our PDB-style files is described here.)

Timeline for d3sfea3: