Lineage for d3sfea1 (3sfe A:10-273,A:361-445)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109341Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2109342Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2109781Family c.3.1.4: Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain [51934] (5 proteins)
  6. 2109852Protein Succinate dehydogenase [82311] (2 species)
  7. 2109868Species Pig (Sus scrofa) [TaxId:9823] [254823] (5 PDB entries)
  8. 2109871Domain d3sfea1: 3sfe A:10-273,A:361-445 [249427]
    Other proteins in same PDB: d3sfea2, d3sfea3, d3sfeb1, d3sfeb2, d3sfec_, d3sfed_
    automated match to d1zoya1
    complexed with f3s, fad, fes, hem, oaa, sf4, tmg

Details for d3sfea1

PDB Entry: 3sfe (more details), 2.81 Å

PDB Description: crystal structure of porcine mitochondrial respiratory complex II bound with oxaloacetate and thiabendazole
PDB Compounds: (A:) Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial

SCOPe Domain Sequences for d3sfea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sfea1 c.3.1.4 (A:10-273,A:361-445) Succinate dehydogenase {Pig (Sus scrofa) [TaxId: 9823]}
stqypvvdhefdavvvgaggaglraafglseagfntacvtklfptrshtvaaqgginaal
gnmeednwrwhfydtvkgsdwlgdqdaihymteqapasvvelenygmpfsrtedgkiyqr
afggqslkfgkggqahrcccvadrtghsllhtlygrslrydtsyfveyfaldllmengec
rgvialciedgsihrirarntvvatggygrtyfsctsahtstgdgtamvtraglpcqdle
fvqfhptgiygagclitegcrgegXlptvhynmggiptnykgqvlrhvngqdqvvpglya
cgeaacasvhganrlganslldlvvfgracalsiaescrpgdkvpsikpn

SCOPe Domain Coordinates for d3sfea1:

Click to download the PDB-style file with coordinates for d3sfea1.
(The format of our PDB-style files is described here.)

Timeline for d3sfea1: