| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) ![]() |
| Family c.3.1.4: Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain [51934] (5 proteins) |
| Protein Succinate dehydogenase [82311] (3 species) |
| Species Pig (Sus scrofa) [TaxId:9823] [254823] (5 PDB entries) |
| Domain d3sfea1: 3sfe A:10-273,A:361-445 [249427] Other proteins in same PDB: d3sfea2, d3sfea3, d3sfeb1, d3sfeb2, d3sfec_, d3sfed_ automated match to d1zoya1 complexed with f3s, fad, fes, hem, oaa, sf4, tmg |
PDB Entry: 3sfe (more details), 2.81 Å
SCOPe Domain Sequences for d3sfea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sfea1 c.3.1.4 (A:10-273,A:361-445) Succinate dehydogenase {Pig (Sus scrofa) [TaxId: 9823]}
stqypvvdhefdavvvgaggaglraafglseagfntacvtklfptrshtvaaqgginaal
gnmeednwrwhfydtvkgsdwlgdqdaihymteqapasvvelenygmpfsrtedgkiyqr
afggqslkfgkggqahrcccvadrtghsllhtlygrslrydtsyfveyfaldllmengec
rgvialciedgsihrirarntvvatggygrtyfsctsahtstgdgtamvtraglpcqdle
fvqfhptgiygagclitegcrgegXlptvhynmggiptnykgqvlrhvngqdqvvpglya
cgeaacasvhganrlganslldlvvfgracalsiaescrpgdkvpsikpn
Timeline for d3sfea1:
View in 3DDomains from other chains: (mouse over for more information) d3sfeb1, d3sfeb2, d3sfec_, d3sfed_ |