![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
![]() | Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) ![]() two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains |
![]() | Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (7 proteins) consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups |
![]() | Protein Small cytochrome binding protein CybS [254391] (1 species) Pfam PF05328; PubMed 15989954 |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [254827] (5 PDB entries) |
![]() | Domain d3sfdd_: 3sfd D: [249426] Other proteins in same PDB: d3sfda1, d3sfda2, d3sfda3, d3sfdb1, d3sfdb2, d3sfdc_ automated match to d1zoyd_ complexed with f3s, fad, fes, hem, oaa, pci, sf4 |
PDB Entry: 3sfd (more details), 2.61 Å
SCOPe Domain Sequences for d3sfdd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sfdd_ f.21.2.2 (D:) Small cytochrome binding protein CybS {Pig (Sus scrofa) [TaxId: 9823]} sskaaslhwtgervvsvlllgllpaaylnpcsamdyslaaaltlhghwgigqvvtdyvrg dalqkaakagllalsaftfaglcyfnyhdvgickavamlwkl
Timeline for d3sfdd_: