SCOPe 2.04: Domain d3sfdc_: 3sfd C:

Lineage for d3sfdc_ (3sfd C:)

1. Root: SCOPe 2.04

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
   core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices

4. Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families)
   two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains

5. Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (7 proteins)
   consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups

6. Protein Large cytochrome binding protein CybL [254390] (1 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [254826] (5 PDB entries)

8. Domain d3sfdc_: 3sfd C: [249425]
   Other proteins in same PDB: d3sfda1, d3sfda2, d3sfda3, d3sfdb1, d3sfdb2, d3sfdd_
   automated match to d1zoyc_
   complexed with f3s, fad, fes, hem, oaa, pci, sf4

Details for d3sfdc_

PDB Entry: 3sfd, 2.61 Å

PDB Description: crystal structure of porcine mitochondrial respiratory complex II bound with oxaloacetate and pentachlorophenol

PDB Compounds: (C:) Succinate dehydrogenase cytochrome b560 subunit, mitochondrial

SCOPe Domain Sequences for d3sfdc_:

Sequence; same for both SEQRES and ATOM records:

>d3sfdc_ f.21.2.2 (C:) Large cytochrome binding protein CybL {Pig (Sus scrofa) [TaxId: 9823]}
ttakeemerfwnknlgsnrplsphitiyrwslpmamsichrgtgialsagvslfglsall
lpgnfeshlelvkslclgptliytakfgivfplmyhtwngirhliwdlgkgltipqltqs
gvvvliltvlssvglaam

Timeline for d3sfdc_:

• d3sfdc_ is new in SCOPe 2.04-stable
  
• d3sfdc_ appears in SCOPe 2.05
  
• d3sfdc_ appears in the current release, SCOPe 2.08