![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) ![]() |
![]() | Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins) |
![]() | Protein Succinate dehydogenase iron-sulfur protein, N-terminal domain [82586] (3 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [254758] (5 PDB entries) |
![]() | Domain d3sfdb1: 3sfd B:9-114 [249423] Other proteins in same PDB: d3sfda1, d3sfda2, d3sfda3, d3sfdb2, d3sfdc_, d3sfdd_ automated match to d1zoyb1 complexed with f3s, fad, fes, hem, oaa, pci, sf4 |
PDB Entry: 3sfd (more details), 2.61 Å
SCOPe Domain Sequences for d3sfdb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sfdb1 d.15.4.2 (B:9-114) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} prikkfaiyrwdpdktgdkphmqtyeidlnncgpmvldalikikneidstltfrrscreg icgscamninggntlactrridtnldkvskiyplphmyvikdlvpd
Timeline for d3sfdb1: