Lineage for d3sfda3 (3sfd A:446-622)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696503Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2696597Superfamily a.7.3: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46977] (1 family) (S)
  5. 2696598Family a.7.3.1: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46978] (4 proteins)
  6. 2696637Protein Succinate dehydogenase [81708] (3 species)
  7. 2696659Species Pig (Sus scrofa) [TaxId:9823] [254825] (5 PDB entries)
  8. 2696661Domain d3sfda3: 3sfd A:446-622 [249422]
    Other proteins in same PDB: d3sfda1, d3sfda2, d3sfdb1, d3sfdb2, d3sfdc_, d3sfdd_
    automated match to d1zoya3
    complexed with f3s, fad, fes, hem, oaa, pci, sf4

Details for d3sfda3

PDB Entry: 3sfd (more details), 2.61 Å

PDB Description: crystal structure of porcine mitochondrial respiratory complex II bound with oxaloacetate and pentachlorophenol
PDB Compounds: (A:) Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial

SCOPe Domain Sequences for d3sfda3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sfda3 a.7.3.1 (A:446-622) Succinate dehydogenase {Pig (Sus scrofa) [TaxId: 9823]}
ageesvmnldklrfangtirtselrlsmqksmqshaavfrvgsvlqegcekilrlygdlq
hlktfdrgmvwntdlvetlelqnlmlcalqtiygaearkesrgaharedfkervdeydys
kpiqgqqkkpfqehwrkhtlsyvdvktgkvsleyrpvidktlneadcatvppairsy

SCOPe Domain Coordinates for d3sfda3:

Click to download the PDB-style file with coordinates for d3sfda3.
(The format of our PDB-style files is described here.)

Timeline for d3sfda3: