Lineage for d3sfda1 (3sfd A:10-273,A:361-445)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1832628Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 1832629Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 1833063Family c.3.1.4: Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain [51934] (5 proteins)
  6. 1833132Protein Succinate dehydogenase [82311] (2 species)
  7. 1833148Species Pig (Sus scrofa) [TaxId:9823] [254823] (5 PDB entries)
  8. 1833152Domain d3sfda1: 3sfd A:10-273,A:361-445 [249420]
    Other proteins in same PDB: d3sfda2, d3sfda3, d3sfdb1, d3sfdb2, d3sfdc_, d3sfdd_
    automated match to d1zoya1
    complexed with f3s, fad, fes, hem, oaa, pci, sf4

Details for d3sfda1

PDB Entry: 3sfd (more details), 2.61 Å

PDB Description: crystal structure of porcine mitochondrial respiratory complex II bound with oxaloacetate and pentachlorophenol
PDB Compounds: (A:) Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial

SCOPe Domain Sequences for d3sfda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sfda1 c.3.1.4 (A:10-273,A:361-445) Succinate dehydogenase {Pig (Sus scrofa) [TaxId: 9823]}
stqypvvdhefdavvvgaggaglraafglseagfntacvtklfptrshtvaaqgginaal
gnmeednwrwhfydtvkgsdwlgdqdaihymteqapasvvelenygmpfsrtedgkiyqr
afggqslkfgkggqahrcccvadrtghsllhtlygrslrydtsyfveyfaldllmengec
rgvialciedgsihrirarntvvatggygrtyfsctsahtstgdgtamvtraglpcqdle
fvqfhptgiygagclitegcrgegXlptvhynmggiptnykgqvlrhvngqdqvvpglya
cgeaacasvhganrlganslldlvvfgracalsiaescrpgdkvpsikpn

SCOPe Domain Coordinates for d3sfda1:

Click to download the PDB-style file with coordinates for d3sfda1.
(The format of our PDB-style files is described here.)

Timeline for d3sfda1: