![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) ![]() |
![]() | Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
![]() | Protein automated matches [254633] (16 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [255790] (18 PDB entries) |
![]() | Domain d3sepc4: 3sep C:626-730 [249410] Other proteins in same PDB: d3sepa1, d3sepa3, d3sepa5, d3sepb1, d3sepb3, d3sepb5, d3sepc1, d3sepc3, d3sepc5, d3sepd1, d3sepd3, d3sepd5 automated match to d1jz8a2 complexed with dms, mg, na |
PDB Entry: 3sep (more details), 2.05 Å
SCOPe Domain Sequences for d3sepc4:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sepc4 b.1.4.0 (C:626-730) automated matches {Escherichia coli K-12 [TaxId: 83333]} ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl
Timeline for d3sepc4:
![]() Domains from same chain: (mouse over for more information) d3sepc1, d3sepc2, d3sepc3, d3sepc5 |