Lineage for d1ltge_ (1ltg E:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58940Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 59002Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 59003Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 59051Protein Heat-labile toxin [50205] (2 species)
  7. 59052Species Escherichia coli, type IB [TaxId:562] [50206] (17 PDB entries)
  8. 59129Domain d1ltge_: 1ltg E: [24941]
    Other proteins in same PDB: d1ltg.1

Details for d1ltge_

PDB Entry: 1ltg (more details), 2.4 Å

PDB Description: the arg7lys mutant of heat-labile enterotoxin exhibits great flexibility of active site loop 47-56 of the a subunit

SCOP Domain Sequences for d1ltge_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ltge_ b.40.2.1 (E:) Heat-labile toxin {Escherichia coli, type IB}
apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn

SCOP Domain Coordinates for d1ltge_:

Click to download the PDB-style file with coordinates for d1ltge_.
(The format of our PDB-style files is described here.)

Timeline for d1ltge_: