Lineage for d3sepc2 (3sep C:220-333)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2762430Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2762928Family b.1.4.0: automated matches [254272] (1 protein)
    not a true family
  6. 2762929Protein automated matches [254633] (19 species)
    not a true protein
  7. 2763012Species Escherichia coli K-12 [TaxId:83333] [255790] (18 PDB entries)
  8. 2763137Domain d3sepc2: 3sep C:220-333 [249408]
    Other proteins in same PDB: d3sepa1, d3sepa3, d3sepa5, d3sepb1, d3sepb3, d3sepb5, d3sepc1, d3sepc3, d3sepc5, d3sepd1, d3sepd3, d3sepd5
    automated match to d1jz8a1
    complexed with dms, mg, na

Details for d3sepc2

PDB Entry: 3sep (more details), 2.05 Å

PDB Description: e. coli (lacz) beta-galactosidase (s796a)
PDB Compounds: (C:) beta-galactosidase

SCOPe Domain Sequences for d3sepc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sepc2 b.1.4.0 (C:220-333) automated matches {Escherichia coli K-12 [TaxId: 83333]}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr

SCOPe Domain Coordinates for d3sepc2:

Click to download the PDB-style file with coordinates for d3sepc2.
(The format of our PDB-style files is described here.)

Timeline for d3sepc2: