![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
![]() | Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) ![]() probable carbohydrate-binding domain in enzymes acting on sugars |
![]() | Family b.30.5.0: automated matches [227145] (1 protein) not a true family |
![]() | Protein automated matches [226849] (8 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [255791] (18 PDB entries) |
![]() | Domain d3sepb5: 3sep B:731-1023 [249406] Other proteins in same PDB: d3sepa1, d3sepa2, d3sepa3, d3sepa4, d3sepb1, d3sepb2, d3sepb3, d3sepb4, d3sepc1, d3sepc2, d3sepc3, d3sepc4, d3sepd1, d3sepd2, d3sepd3, d3sepd4 automated match to d1jz8a4 complexed with dms, mg, na |
PDB Entry: 3sep (more details), 2.05 Å
SCOPe Domain Sequences for d3sepb5:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sepb5 b.30.5.0 (B:731-1023) automated matches {Escherichia coli K-12 [TaxId: 83333]} paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld ndigvaeatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
Timeline for d3sepb5:
![]() Domains from same chain: (mouse over for more information) d3sepb1, d3sepb2, d3sepb3, d3sepb4 |