Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) |
Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
Protein automated matches [254633] (16 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [255790] (18 PDB entries) |
Domain d3sepb2: 3sep B:220-333 [249403] Other proteins in same PDB: d3sepa1, d3sepa3, d3sepa5, d3sepb1, d3sepb3, d3sepb5, d3sepc1, d3sepc3, d3sepc5, d3sepd1, d3sepd3, d3sepd5 automated match to d1jz8a1 complexed with dms, mg, na |
PDB Entry: 3sep (more details), 2.05 Å
SCOPe Domain Sequences for d3sepb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sepb2 b.1.4.0 (B:220-333) automated matches {Escherichia coli K-12 [TaxId: 83333]} tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr
Timeline for d3sepb2:
View in 3D Domains from same chain: (mouse over for more information) d3sepb1, d3sepb3, d3sepb4, d3sepb5 |