Class b: All beta proteins [48724] (178 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
Protein automated matches [190770] (49 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [255789] (18 PDB entries) |
Domain d3sepb1: 3sep B:9-219 [249402] Other proteins in same PDB: d3sepa2, d3sepa3, d3sepa4, d3sepa5, d3sepb2, d3sepb3, d3sepb4, d3sepb5, d3sepc2, d3sepc3, d3sepc4, d3sepc5, d3sepd2, d3sepd3, d3sepd4, d3sepd5 automated match to d1f49a3 complexed with dms, mg, na |
PDB Entry: 3sep (more details), 2.05 Å
SCOPe Domain Sequences for d3sepb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sepb1 b.18.1.0 (B:9-219) automated matches {Escherichia coli K-12 [TaxId: 83333]} vvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapea vpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfn vdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmv lrwsdgsyledqdmwrmsgifrdvsllhkpt
Timeline for d3sepb1:
View in 3D Domains from same chain: (mouse over for more information) d3sepb2, d3sepb3, d3sepb4, d3sepb5 |