SCOPe 2.05: Domain d3seib1: 3sei B:1-71

Lineage for d3seib1 (3sei B:1-71)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (4 families)

5. Family a.60.1.0: automated matches [191306] (1 protein)
   not a true family

6. Protein automated matches [190031] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188353] (21 PDB entries)

8. Domain d3seib1: 3sei B:1-71 [249395]
   automated match to d1b4fg_
   complexed with cl, so4

Details for d3seib1

PDB Entry: 3sei, 2.4 Å

PDB Description: Crystal Structure of Caskin1 Tandem SAMs

PDB Compounds: (B:) Caskin-1

SCOPe Domain Sequences for d3seib1:

Sequence; same for both SEQRES and ATOM records:

>d3seib1 a.60.1.0 (B:1-71) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tregksseavsqwltafqlqlyapnfisagydlptisrmtpedltaigvtkpghrkkiaa
eisglsipdwl

Timeline for d3seib1:

• d3seib1 first appeared in SCOPe 2.04
  
• d3seib1 appears in SCOPe 2.06
  
• d3seib1 appears in the current release, SCOPe 2.08