Lineage for d3seia1 (3sei A:3-71)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2001088Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2001089Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 2001227Family a.60.1.0: automated matches [191306] (1 protein)
    not a true family
  6. 2001228Protein automated matches [190031] (2 species)
    not a true protein
  7. 2001237Species Human (Homo sapiens) [TaxId:9606] [188353] (22 PDB entries)
  8. 2001243Domain d3seia1: 3sei A:3-71 [249393]
    Other proteins in same PDB: d3seia3, d3seia4, d3seib3, d3seib4
    automated match to d1b4fg_
    complexed with cl, so4

Details for d3seia1

PDB Entry: 3sei (more details), 2.4 Å

PDB Description: Crystal Structure of Caskin1 Tandem SAMs
PDB Compounds: (A:) Caskin-1

SCOPe Domain Sequences for d3seia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3seia1 a.60.1.0 (A:3-71) automated matches {Human (Homo sapiens) [TaxId: 9606]}
egksseavsqwltafqlqlyapnfisagydlptisrmtpedltaigvtkpghrkkiaaei
sglsipdwl

SCOPe Domain Coordinates for d3seia1:

Click to download the PDB-style file with coordinates for d3seia1.
(The format of our PDB-style files is described here.)

Timeline for d3seia1: