Lineage for d3se6b4 (3se6 B:638-961)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1500528Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 1501071Family a.118.1.0: automated matches [191340] (1 protein)
    not a true family
  6. 1501072Protein automated matches [190220] (10 species)
    not a true protein
  7. 1501096Species Human (Homo sapiens) [TaxId:9606] [189070] (23 PDB entries)
  8. 1501123Domain d3se6b4: 3se6 B:638-961 [249392]
    Other proteins in same PDB: d3se6a1, d3se6a2, d3se6a3, d3se6b1, d3se6b2, d3se6b3
    automated match to d2yd0a4
    complexed with lys, mes, nag, zn

Details for d3se6b4

PDB Entry: 3se6 (more details), 3.08 Å

PDB Description: crystal structure of the human endoplasmic reticulum aminopeptidase 2
PDB Compounds: (B:) Endoplasmic reticulum aminopeptidase 2

SCOPe Domain Sequences for d3se6b4:

Sequence; same for both SEQRES and ATOM records: (download)

>d3se6b4 a.118.1.0 (B:638-961) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hgwdqlitqlnqnhtllrpkdrvglihdvfqlvgagrltldkaldmtyylqhetsspall
eglsylesfyhmmdrrnisdisenlkryllqyfkpvidrqswsdkgsvwdrmlrsallkl
acdlnhapciqkaaelfsqwmessgklniptdvlkivysvgaqttagwnylleqyelsms
saeqnkilyalstskhqekllklielgmegkviktqnlaallhaiarrpkgqqlawdfvr
enwthllkkfdlgsydirmiisgttahfsskdklqevklffesleaqgshldifqtvlet
itknikwleknlptlrtwlmvntr

SCOPe Domain Coordinates for d3se6b4:

Click to download the PDB-style file with coordinates for d3se6b4.
(The format of our PDB-style files is described here.)

Timeline for d3se6b4: