Lineage for d3sdxh1 (3sdx H:1-118)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1519212Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)
  8. 1520274Domain d3sdxh1: 3sdx H:1-118 [249383]
    Other proteins in same PDB: d3sdxa1, d3sdxb_, d3sdxc1, d3sdxd_, d3sdxe2, d3sdxg2
    automated match to d2nw2b1
    complexed with gcy

Details for d3sdxh1

PDB Entry: 3sdx (more details), 3.12 Å

PDB Description: Crystal structure of human autoreactive-Valpha24 NKT TCR in complex with CD1d-beta-galactosylceramide
PDB Compounds: (H:) NKT TCR autoreactive-Vbeta11 chain

SCOPe Domain Sequences for d3sdxh1:

Sequence, based on SEQRES records: (download)

>d3sdxh1 b.1.1.0 (H:1-118) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eadiyqtprylvigtgkkitlecsqtmghdkmywyqqdpgmelhlihysygvnstekgdl
ssestvsrirtehfpltlesarpshtsqylcassefggtertqetqyfgpgtrllvle

Sequence, based on observed residues (ATOM records): (download)

>d3sdxh1 b.1.1.0 (H:1-118) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eadiyqtprylvigtgkkitlecsqtmghdkmywyqqdpgmelhlihysygvnstekgss
estvsrirtehfpltlesarpshtsqylcasseftqetqyfgpgtrllvle

SCOPe Domain Coordinates for d3sdxh1:

Click to download the PDB-style file with coordinates for d3sdxh1.
(The format of our PDB-style files is described here.)

Timeline for d3sdxh1: