Lineage for d3sdxg2 (3sdx G:115-203)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2751830Domain d3sdxg2: 3sdx G:115-203 [249382]
    Other proteins in same PDB: d3sdxa1, d3sdxa2, d3sdxa3, d3sdxb_, d3sdxc1, d3sdxc2, d3sdxd_, d3sdxe1, d3sdxf1, d3sdxf2, d3sdxg1, d3sdxh1, d3sdxh2
    automated match to d4eura2
    complexed with gcy

Details for d3sdxg2

PDB Entry: 3sdx (more details), 3.12 Å

PDB Description: Crystal structure of human autoreactive-Valpha24 NKT TCR in complex with CD1d-beta-galactosylceramide
PDB Compounds: (G:) NKT TCR Valpha24 chain

SCOPe Domain Sequences for d3sdxg2:

Sequence, based on SEQRES records: (download)

>d3sdxg2 b.1.1.2 (G:115-203) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Sequence, based on observed residues (ATOM records): (download)

>d3sdxg2 b.1.1.2 (G:115-203) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdssvclftdfdsqtnvsqssdvyitdkcvldmrsmdfksnsavawsnk
sdfacanafnnsiipedtffps

SCOPe Domain Coordinates for d3sdxg2:

Click to download the PDB-style file with coordinates for d3sdxg2.
(The format of our PDB-style files is described here.)

Timeline for d3sdxg2: