![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (16 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187221] (1204 PDB entries) |
![]() | Domain d3sdxg2: 3sdx G:115-203 [249382] Other proteins in same PDB: d3sdxa1, d3sdxa2, d3sdxa3, d3sdxb_, d3sdxc1, d3sdxc2, d3sdxd_, d3sdxe1, d3sdxf1, d3sdxf2, d3sdxg1, d3sdxh1, d3sdxh2 automated match to d4eura2 complexed with gcy |
PDB Entry: 3sdx (more details), 3.12 Å
SCOPe Domain Sequences for d3sdxg2:
Sequence, based on SEQRES records: (download)
>d3sdxg2 b.1.1.2 (G:115-203) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnksdfacanafnnsiipedtffps
>d3sdxg2 b.1.1.2 (G:115-203) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqnpdpavyqlrdssvclftdfdsqtnvsqssdvyitdkcvldmrsmdfksnsavawsnk sdfacanafnnsiipedtffps
Timeline for d3sdxg2: