Lineage for d3sdxf2 (3sdx F:119-247)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2758378Domain d3sdxf2: 3sdx F:119-247 [249380]
    Other proteins in same PDB: d3sdxa1, d3sdxa3, d3sdxb_, d3sdxc1, d3sdxd_, d3sdxe2, d3sdxg2
    automated match to d2nw2b2
    complexed with gcy

Details for d3sdxf2

PDB Entry: 3sdx (more details), 3.12 Å

PDB Description: Crystal structure of human autoreactive-Valpha24 NKT TCR in complex with CD1d-beta-galactosylceramide
PDB Compounds: (F:) NKT TCR autoreactive-Vbeta11 chain

SCOPe Domain Sequences for d3sdxf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sdxf2 b.1.1.0 (F:119-247) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

SCOPe Domain Coordinates for d3sdxf2:

Click to download the PDB-style file with coordinates for d3sdxf2.
(The format of our PDB-style files is described here.)

Timeline for d3sdxf2: